SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001380186.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001380186.2.35504
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-37
Family Second domain of FERM 0.000000786
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-25
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 4 Region: 505-581
Classification Level Classification E-value
Superfamily Moesin tail domain 1.83e-21
Family Moesin tail domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001380186.2.35504
Sequence length 590
Comment PREDICTED: merlin isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
QEMWEERITSWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQLKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRVKATAIRTE
EEKRLMEQKVLEAEMLALKMAEESERRAKEADQLKQDLQEARESERRTKQKLLEITSKAT
YTPPVSSSTAALPADMPGFTLIGESLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQL
NELKTEIEALKLKERETALDILHNENSDRGGSKHNTIKKPQAQGRRPICI
Download sequence
Identical sequences F7GLA2
ENSMODP00000011100 XP_001380186.2.35504 ENSMODP00000011100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]