SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001381651.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001381651.2.35504
Domain Number 1 Region: 60-176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000663
Family Spermadhesin, CUB domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001381651.2.35504
Sequence length 325
Comment PREDICTED: corticotropin-releasing factor-binding protein [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MRSRMSPAFKLQCHFILIFLGALRGETRYLELREVAEADPLLLFNTDLKRELSEEQLYHR
SLRCIDMLSIEGQFTFTAEQPQLQCAAFFIGEPEEVISIQYDLVSVDCQGGDFLKVFDGW
ILKGEKFPSSQDHPLPMSDRYIDFCESENIRTFSSSQNVAMIFFRIHEPGNGFTITVKKN
PNLFPCNVISQTPNGRFTMVIPHQHRNCSFSIIYPVVIKISDLILGHLNGLQLKKPSVGC
GGIGDFVELLGGTGLDPSKMMPFADLCYPFHGPAQLTIGCDNTVVRMVSSGKHVNRVTFE
YHQLEPYDLGSPSGNSIKEYCFPSI
Download sequence
Identical sequences F6WNR7
ENSMODP00000024647 XP_001381651.2.35504 ENSMODP00000024647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]