SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001425492.1.48737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001425492.1.48737
Domain Number 1 Region: 69-198
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-35
Family Ran-binding domain 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001425492.1.48737
Sequence length 211
Comment hypothetical protein (macronuclear) [Paramecium tetraurelia strain d4-2]; AA=GCF_000165425.1; RF=representative genome; TAX=5888; STAX=5888; NAME=Paramecium tetraurelia; strain=Stock d4-2; AL=Scaffold; RT=Major
Sequence
MYYRNLINTDSQIPKDSIVQKSQLKDITHQYKFKYLNNFLIQSMDPHGDDDEQVGEDYNP
EQEVFVGEGQATLPQLPVQTGEENDEEVAKFRAKIYRFADAQWKERGVGDMKFLKNKQTN
KIRLLMRQDKTGKLIANHFITAQEGFCKLSQLKTADKSWIWTCYDASDEQPKVWQLCVRF
ISPEEVERFKTEFEKAYESNKALQEEVPKNE
Download sequence
Identical sequences A0BHS7
GSPATP00029130001 XP_001425492.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]