SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001464193.1.40037 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001464193.1.40037
Domain Number 1 Region: 443-549
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000108
Family Calponin-homology domain, CH-domain 0.0077
Further Details:      
 
Weak hits

Sequence:  XP_001464193.1.40037
Domain Number - Region: 326-395
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0262
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001464193.1.40037
Sequence length 1029
Comment conserved hypothetical protein [Leishmania infantum JPCM5]; AA=GCF_000002875.2; RF=representative genome; TAX=435258; STAX=5671; NAME=Leishmania infantum JPCM5; strain=JPCM5; AL=Chromosome; RT=Major
Sequence
MSASRQASKVSATARATKFSAIRKLPTAKQSTSAVAAAHTSSDEPRRPALISFDVDATID
TVNSLHEEQHRVSEEDVTDKRIGRYHYAQLVARLNEQRSLYQSTAVFVETMLKEVNHSTE
ASVAMKASAATWGLKLLAKHAGYGAISTVLESLLPALYCEYSPEKLCRASPAVELQVRRP
DVLMDNPYFTHSMFVDEVQVDKRSATKLQKSLEAALRANDQRRSIVCHLIERQRQQQLEV
VFRCWRHHVRQQHLLRMMGDNTAKQWADEMSRLRVQAVFYHWKLLVERSRSTYLTERLHE
AAFQLENAKNQFQLQCYRADRLVRTAKEATEEMERVSQINEDLQRQVDELKEEQVRKERE
YKEKLTRNVTQVLKLLETYDALARVLLHSKQADEYFMPEKPLLARHSQSGDGGEEASENE
GQLLEVNAVAEASWESPSGSALQCLRQWCDGVLGQASGRTEPFKPIRSFGADFSNGERYL
YIFQHVFPEVVPTVLQIHDMDVESRLRRIRGYVADCGLRYRLVPSDLMNQREDLLVCSLS
ELYQQHLLRKWDQMVSRSMTELNALREGDMKEALLGCTASSSTEDVADVPAEQLDEAAVR
AHVSDYVERVKAMSEEFRTSLAVENEVVKASTAIAVQEARLGGERLQGTPIPLVDEAERC
AFWKLPAGALDDLRGAKKLNSEERMWNLIVTQTLPEVLQAHVDTTSRLFYLFAGENAKSL
SEVAFWRLVECSGILVGGMEVPMDWIARQYDHVVTPQLDAALRAVARNQSEMSVQKLRQV
AYQEMDIRSATPQQFVELLVRLAMASEKGKYGLVEGTRRLLQGLQLLNNEISPVARALHE
PEAQHVLRFFNEDLFRVYLFYVKKQESSRNTQDASMATQFGGRFASQMSITMLLTMLEDC
RFLLDGSGRRNSSIGVSADFTRPLFFINAAQVRKVVSALGSFCKGAMSGGLSFNLFVDTL
AVLAHHWCPDPLVPEPRRLAGFLAHTVQQLSARHINSTLLLGTVPSIRLEGPRNVDFSQE
ARPSVGTVA
Download sequence
Identical sequences A4HVV2
XP_001464193.1.40037 psu|LinJ14_V3.0100 gi|146081198|ref|XP_001464193.1| 5671.LinJ14.0100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]