SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001466930.1.40037 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001466930.1.40037
Domain Number 1 Region: 103-401
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-83
Family Protein kinases, catalytic subunit 0.00000207
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000155
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001466930.1.40037
Sequence length 510
Comment putative protein kinase [Leishmania infantum JPCM5]; AA=GCF_000002875.2; RF=representative genome; TAX=435258; STAX=5671; NAME=Leishmania infantum JPCM5; strain=JPCM5; AL=Chromosome; RT=Major
Sequence
MSGYLKVLSPDGRWETRYVEIDDAKLRIWRTKGDKESSAAVVKELDLKCATLREVSEPNT
WAVQPEKAEATYFQADGEERKTEWMDTLRHYNSSSSASEKVTLRDFEKKFVLGKGSYGKV
FMVVKKDTDKWYAMKEMSAEKMRQAEIKAPFAERIILEEIDHPFIVHLHYSFQEQGNLYM
ILDLLAGGELFTYIEQHAPLDEEVVKFYAAEVALALGYLHSRNIIYRDLKPENVVFDRDG
HACLTDFGLAKANVHEPNAVTYCGTNEYLAPELLKGVPHGKAVDWWSLGLMMCEMLFNDL
PFYDENPMQMQMKILTEDVAFPPHIQITEETKDLIRCLLNKNPERRLQTLEAFKAHKCFS
NLDFGLLEARKLKAPITPDPNPAHNFAKEFTSEVIVQNESPSQAVVTLAGYTYDRDLSEQ
EKSPSHSPTIAEELRQRRASMKKSTNGSDAASPPVTGENRTSNSSPAGAPTKQAAAGPVK
KVEHHIPAKVAPQAARKKLTGNKSFDKPTK
Download sequence
Identical sequences A4I5B1
gi|146093638|ref|XP_001466930.1| 5671.LinJ30.1160 psu|LinJ30_V3.0850 XP_001466930.1.40037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]