SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001467780.1.40037 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001467780.1.40037
Domain Number 1 Region: 543-677
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.7e-23
Family Staphylococcal nuclease 0.003
Further Details:      
 
Domain Number 2 Region: 168-299
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.84e-20
Family Staphylococcal nuclease 0.0028
Further Details:      
 
Domain Number 3 Region: 361-510
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 5.89e-20
Family Staphylococcal nuclease 0.013
Further Details:      
 
Domain Number 4 Region: 4-144
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.18e-16
Family Staphylococcal nuclease 0.016
Further Details:      
 
Domain Number 5 Region: 739-829
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000421
Family Tudor domain 0.0069
Further Details:      
 
Domain Number 6 Region: 778-929
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000000706
Family Staphylococcal nuclease 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001467780.1.40037
Sequence length 934
Comment conserved hypothetical protein [Leishmania infantum JPCM5]; AA=GCF_000002875.2; RF=representative genome; TAX=435258; STAX=5671; NAME=Leishmania infantum JPCM5; strain=JPCM5; AL=Chromosome; RT=Major
Sequence
MSYVVYAVENADRMILMGPTVADQPTFKAITLSYIQAPKLARRTASGDFTPEEPYAYEAA
ELIRSTFIGKQVQFVEDYYIEALQRSAGRIMGSNHQEATGMLLKEGLATLPDRMPPRIEK
ELYEIYSQMSASARAARKGLFSGDSAKHVRHMRSYAPEELAEKIEGVKGQQLLSRVEKVV
SPTLLIISVKELGDTQFAAHLTGVTTKDNGDESINAEAKFFVERLLQNRNVKVRYDGLDG
FNNVMISIMSPKGSFQEELLSKGYVKVHNMTLPLSTRIDEIASAEAAAKKKRVGCWKNYV
EPVVIAPTETAKDDNGASAPAANGEEALVDSKAPAAPKVAGLPTTLPDGTPGPVYTGPIE
FVGTLVQVVHGDTVVVRDDASGRLFRVSLAGVRSSKNIDRDQDGNSPETRVTYRDYSWEA
KEFLRSRYIGAKVVVLVEYARVMPETKEIRPAATVEVKHTGVNIGVALLETGYATFFLGR
NDKNSKASELAAAEDGAKEEKKGIHRDTPAPPMKVVELNHLGETRSRYYLSFLQRGMQGS
RPPSLKGVVDLVLGPSSLRVYIPKENFQIPVKVAGIVTPSAAFNPNEKADPFAQEAKDFV
IDLVQQRNATIQVFTSDRAGNFISSVTLEDGTNISVALVAEGFATVANADRLPFAQQLVD
AEGAAREAKKHIWSATGAIPQRAVKMEQERAASNPQALARVVDETSKFAPYMITEIADDG
LSVYLQGYDAEQDSRKGHIQDLINRTAAGDGHTPKKGESVIAQYSGDKTWCRATVLKAPR
DDRAEVKFIDFGNTETVPVKNIRAVPRGPEYALVRDTPAFAKLARLAYLKSGDANEMLAG
ATYAAVEEYSDGEVLAKAVYRDGLGNVYYTVTTNANVPSLSETLLQRGLALLDRRASAVD
ATDYRRHEAAQEIARKGHKNLWQYGDIDEADVDY
Download sequence
Identical sequences A4I7R1
gi|146096358|ref|XP_001467780.1| XP_001467780.1.40037 5671.LinJ32.1350 psu|LinJ32_V3.1000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]