SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001468051.1.40037 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001468051.1.40037
Domain Number 1 Region: 103-232
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000822
Family Phosphotyrosine-binding domain (PTB) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001468051.1.40037
Sequence length 272
Comment conserved hypothetical protein [Leishmania infantum JPCM5]; AA=GCF_000002875.2; RF=representative genome; TAX=435258; STAX=5671; NAME=Leishmania infantum JPCM5; strain=JPCM5; AL=Chromosome; RT=Major
Sequence
MLAAQEECRLLAAQLEKSRAARAAFTCGPQGRTRAAPATAPAAATSPPSPQRVYSAATVT
VTVKGPSIGSSTSTSPDRAGSPSAAPPSTSPARVVIPTAATHKEGTLLHLVRGSGLFGGG
SRSFVPHYIVVSGSAGISWYASEAEYRQNPSRPLGHADFWIETFNSRGSRFKKAAVCWPL
ILPDDCPEAKDANKTYFAVDYYTPNEAREQVVLAASSPAERDEWVQVLTKYIDLYLAPRA
ESEELQHIPRGAAVPLHRSGVIEGEAPGGNIL
Download sequence
Identical sequences A4I8I2
gi|146097138|ref|XP_001468051.1| 5671.LinJ32.4140 XP_001468051.1.40037 psu|LinJ32_V3.3780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]