SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001483798.1.35779 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001483798.1.35779
Domain Number 1 Region: 132-256
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000537
Family Thioltransferase 0.079
Further Details:      
 
Domain Number 2 Region: 328-405,432-468
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000517
Family UBX domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001483798.1.35779
Sequence length 469
Comment hypothetical protein PGUG_04527 [Meyerozyma guilliermondii ATCC 6260]; AA=GCF_000149425.1; RF=representative genome; TAX=294746; STAX=4929; NAME=Meyerozyma guilliermondii ATCC 6260; strain=ATCC 6260; AL=Scaffold; RT=Major
Sequence
MTSLFDNLARRFLGQQYAPVSTSEDPESQVRVPGSFAATPEGNQVANSNVSEGHNRLPGD
APIGEEPATAPRAALTSHNLNHVLFRFSTICQLLVYKPLMVVLVLICRVVAAFINVIYFR
DEYAATANNPSDPIDNANKFIRELEYNLQPSEPMHTLPPFFQGSYTQALFMATNRAKFLF
VYLAHPRSENSSGMFENIITAPEFTSIFNDPDYIIWGGDLTSSESYQLANSLNVTRFPFL
GLMCLTRSTTMMPLGPVKSAPKISLVLKVQGRVKDRARAQAIISNKFKNRINKYEADLRE
IRHELMNKYMSQVLVKQQDISYQNSLARDKAKKLKREREGKLLAYLQLKVEHFLQLQNSQ
LPDSARVGIRFSNGNRVTLTLPSTTKVAEIYEFVEIHRRGYDTEPQTLSSQNGQNSQNSL
MSLEIAPDDFKFSLVSSVPPRSLLKDFWESSVRDVNFIYPNGMLIVEDI
Download sequence
Identical sequences XP_001483798.1.35779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]