SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001489287.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001489287.1.31192
Domain Number 1 Region: 215-455
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.51e-85
Family Eukaryotic proteases 0.0000000171
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 2.75e-25
Family GLA-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 133-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001489287.1.31192
Sequence length 457
Comment PREDICTED: coagulation factor IX [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MRCLNMIMAESLGLVTICLLGYLLSAECTVFLDRENATKILNRPKRYNSGKLEEFVRGNL
ERECMEEKCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLHGGVCKDDINSYECWCQ
PGFEGKNCELYATCSIKNGRCKQFCKNSADNKVICSCTAGYRLAEDQKSCEPAVPFPCGK
VSVSHASMKVTRAETIFSNMNYENSTEAETIWDNITEFDLNRVVGGENAKPGQFPWQVLL
HGKIAAFCGGSIINEKWVVTAAHCIEPGVKITVVAGEHNTEEIDHTEQKRNVIRAIPHHS
YNATLNKYNHDIALLELDKPLTLNSYVTPICVADKDYTNIFLKFGSGYVSGWGRVFSRGR
SASILQHLKVPLVDRATCLRSTKFTIHNNMFCAGFHEGGKDSCQGDSGGPHVTEVEGTSF
LTGIISWGEECAVKGKYGIYTKVSRYVNWIKEKTKLT
Download sequence
Identical sequences F6RFT9
XP_001489287.1.31192 9796.ENSECAP00000018890 ENSECAP00000018890 ENSECAP00000018890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]