SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001490688.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001490688.1.31192
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily E set domains 1.54e-44
Family ML domain 0.00000076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001490688.1.31192
Sequence length 149
Comment PREDICTED: epididymal secretory protein E1 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MRSLDAAFLLLALGASALANPVHFKDCGSQVGVVKEVNVNPCSTQPCQLHKGQSYSVNVT
FTSNTQSQSSKAVVHGIVLGVPVPFPIPEPDGCKSGISCPIQKDKSYNYVNKLPVKSEYP
SIKLVVKWELQDDKGQSLFCWEIPVQIEG
Download sequence
Identical sequences F7CIW5
XP_001490688.1.31192 XP_005605383.1.31192 XP_005605384.1.31192 9796.ENSECAP00000015851 ENSECAP00000015851 ENSECAP00000015851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]