SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001490874.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001490874.1.31192
Domain Number 1 Region: 6-362
Classification Level Classification E-value
Superfamily TROVE domain-like 1.44e-132
Family TROVE domain-like 0.0000000000247
Further Details:      
 
Domain Number 2 Region: 364-535
Classification Level Classification E-value
Superfamily vWA-like 8.9e-52
Family RoRNP C-terminal domain-like 0.00000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001490874.1.31192
Sequence length 538
Comment PREDICTED: 60 kDa SS-A/Ro ribonucleoprotein [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MEESVHQKQPLNEKQIANSEDGYVWQVTDLNRLHRFLCFGSEGGTYYIKEEKLGLENAEA
LIRLIEDGRGCEVIQEIKAFSQEGRTAKQEPVLFALAICSQCSDISTKQAAFKAVSEVCR
IPTHLFTFIQFKKDLKASMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHK
DLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVERVKHTKD
ELEVIHLIEEHRLVREHLLTNHLKSKEIWKALLQEMPLTALLRNLGKMTANSVLEPGNSE
VSLVCEKLCNEKLLKKARIHPFHVLIALETYKTGHGLRGKLKWRPDEDILKALDVAFYKT
FKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDFYVVAFSDEMV
PCPLTADMTLQQVLMVMNQIPAGGTDCSLPMIWAQKTNTAADVFIVFTDNETFAGGVHPA
VALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDVI
Download sequence
Identical sequences F7AA69
ENSECAP00000016412 9796.ENSECAP00000016412 ENSECAP00000016412 XP_001490874.1.31192 XP_008540971.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]