SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001492094.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001492094.1.31192
Domain Number 1 Region: 116-415
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.46e-113
Family Pancreatic carboxypeptidases 0.00000000643
Further Details:      
 
Domain Number 2 Region: 18-107
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 9.14e-26
Family Pancreatic carboxypeptidase, activation domain 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001492094.1.31192
Sequence length 417
Comment PREDICTED: carboxypeptidase B [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MLAFLLLVTVTLASAHESGEHFEGEKVFRVKVEDKNHVNLLQELASTNQIDFWKPDSATQ
ITPHSTVDFHVKAEDILTVEDFLEQNELQYEVLIGNLRSALEAQFDSGARATGHSYEKYN
NWETIEAWTKQVASENPNLISRSTIGTTFEGRNIYLLKVGKAGSNKPAIFIDCGFHAREW
ISPAFCQWFVKEAVRTYGSESQMTQLLNTFDFYVVPVLNIDGYVYTWTTNRMWRKTRSVR
SGSTCVGTDPNRNFNAGWCSIGASRSPCADTYCGPAAESEKETKALADFIRKNLSSIKAY
LTIHSYSQMLLYPYSYAYKLPANNAELNTLAKATVNELASLYGTKYTYGPGASTIYPAAG
GSDDWAYDQGIKYSFTFELRDTGRYGFALPESQIRATCEETLRAVKYVASYVLEHLY
Download sequence
Identical sequences F6XIJ7
XP_001492094.1.31192 ENSECAP00000019032 9796.ENSECAP00000019032 ENSECAP00000019032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]