SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001498972.2.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001498972.2.31192
Domain Number 1 Region: 1125-1301
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00087
Further Details:      
 
Domain Number 2 Region: 687-802
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 453-574
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-25
Family Pleckstrin-homology domain (PH domain) 0.0000132
Further Details:      
 
Domain Number 4 Region: 909-1040
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-22
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 5 Region: 1435-1569
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-20
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.13e-16
Family SAM (sterile alpha motif) domain 0.0000365
Further Details:      
 
Domain Number 7 Region: 588-680
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000116
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 8 Region: 1018-1117
Classification Level Classification E-value
Superfamily PH domain-like 0.000000059
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001498972.2.31192
Sequence length 1709
Comment PREDICTED: arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 isoform X1 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFREFGFNTVKDCAAINDSVLHKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKNDETSKDCRAPSSDQNTCIELSNSGRVQTPSPTQLE
TVTRNLDQNDVSVENSQSLKSDDKLSLPKHNFPIPEEEPHLHLGSFQDSLFGSENIKIGS
LITKTTADHAVVEEPVEKVDLISENVSQLTNADPECLSAFGYSLSEAAHSGSGTNGFSER
SPPSPCFQFQGEMVVNDLYVPSSPVPAPVRSRSKLVSRPSRSFMLRHRPVPEIPGTIKGI
SGSYFRERRTVTTSTGKSVTQQNSNEENSSSIFPYGETFLFQKLENSKKKSIKNEFWTHE
ETLKGETTTGRNAFLVQSSIYDNRKEHLSEDKVEDIWIPREDKTNFPIETASESEYSTVE
ECFQSLRRKNSKASKSRTQKALNSDPVNRHSYPSSLTSGNTDSSIISSTAISPYACFYGS
SARKVKSGWLDKLCPQGKRMFQKRWVKFDGLSISYYNNEKEKYSKGIIPLSAVSTVRVQG
DNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQPLSSQPQAVVAPEKCGYLELRGY
KAKIFTVLSGNSVWLCKNEQDFKSGLGITVIPMNVANVKQVDRTVKQSFEIITPYRSFSF
TAESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVI
CKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLKKDEELHM
DSPVEKRKNFITQKYKEGRFRKTLLASLTKEELNKALCAAVVKSDVLETMALLFSGADVM
CATGDPVHSTPYLLAKKAGQSLQMEFLHHNKFSDFPQHDVHSEGGLSQESCQSVFLCDFL
YQAPSAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAVHKE
DFYLNTGPIFTFEIYLPSERAFLFGAETPQAQRKWTEAIAKHFVPFVAENLTEADYDLIG
QLYYKDCHALDQWRKGWFAMDKSSLRFCLQMQEVQEDRMHLRRLQELTISTMVQNGEKMD
VLLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFV
TQYGLGCKYIYQKNGDRLRVSELLENFKKDARSFKLRAGKHQLEDVTGVLKSFLCDIDDA
LLTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHM
DAHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKD
TQVSQAGDLLIEVFVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEV
IENEELERPLHYTENVLEQVLRWSSLAEPGSAYLVVKRFLTVDTIKHYNERKALESIKDG
VLKIKEEPSKILSGNKFQDRYFVLRDGYLFLYKDPKSSKYDRMFSLSSMKFYLGVKKKMK
PPTSWGLTAYSEKHHWHLCCDSLQSQMEWMASIFIAQHENDIRPPAGKERKRSITKNPKI
GGLPLIPIQHEKDAAQAQRNIENARAELERLRLSENRDGESGDPSLKERASIVAHCLEHK
DDKLRHRSRKHRSFNCLEDTEAAVLHGQQKGHKGLKTLRKTEDRNGKAPLDSDNKLPAKV
IEELSVVLQRSRTHPKELQGEQILQKEIK
Download sequence
Identical sequences F7D5V1
ENSECAP00000015998 9796.ENSECAP00000015998 ENSECAP00000015998 XP_001498972.2.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]