SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001499958.2.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001499958.2.31192
Domain Number 1 Region: 25-215
Classification Level Classification E-value
Superfamily PR-1-like 5.89e-55
Family PR-1-like 0.00011
Further Details:      
 
Domain Number 2 Region: 284-382
Classification Level Classification E-value
Superfamily LCCL domain 5.75e-30
Family LCCL domain 0.00095
Further Details:      
 
Domain Number 3 Region: 386-491
Classification Level Classification E-value
Superfamily LCCL domain 8.37e-27
Family LCCL domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001499958.2.31192
Sequence length 497
Comment PREDICTED: cysteine-rich secretory protein LCCL domain-containing 2 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MSCVLKGVVPLGLVLLVCGAQGFFLPNVTHLEKMLSKYQQDRPHSRVRRAIPRADKEEIL
MLHNKLRGQVYPPASNMEHMTWDDELERSAAAWAQECIWEHGPTSLLVSIGQNLAVHWGR
YRSPGFHVQSWYDEVKDYTYPSPDECKPWCPERCSGAMCTHYTQIVWATTNKVGCAVNTC
QRMNVWGEVWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGGCRSNLCYREETY
DQKPETDEMNEVEVAPVPEEKHVWVQPRVVRPTKPKKTPGVNYMTQVVKCDTKLKDKCKG
STCNRYQCPAGCLNSKAKIFGTLFYESASSICRAAIHYGILDDKGGLVDVTRNGKVPFFV
KSERNGVESLSKYKSSSSFTVSKVKVQDLDCYTTVAQLCPFVKTGTHCPRVRCSAYCKDE
PSYWAPVFGSNIYADTSSICKAAVHAGVIRNESGGYVDVMPVDKKKIYVGSLRNGVQSES
LRTPRDGKAFRIFAVRP
Download sequence
Identical sequences F6SS57
ENSECAP00000022211 XP_001499958.2.31192 ENSECAP00000022211 9796.ENSECAP00000022211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]