SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001502775.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001502775.1.31192
Domain Number 1 Region: 110-441
Classification Level Classification E-value
Superfamily Subtilisin-like 6.15e-98
Family Subtilases 0.00000000000549
Further Details:      
 
Domain Number 2 Region: 435-574
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.1e-42
Family Proprotein convertase P-domain 0.000000374
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.33e-23
Family Prohormone convertase 1 pro-domain 0.0033
Further Details:      
 
Domain Number 4 Region: 585-675
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000124
Family Growth factor receptor domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001502775.1.31192
Sequence length 793
Comment PREDICTED: furin [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MELRPWLLWVVAAAIALVLLAADARGQKVFTNTWAVRIAGGPAVADSVARKHGFLNLGQI
FSDYYHFWHRAVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGITQRDLNVKDAWAQGYTGRGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQLGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPSH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPTPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFTPQVLNTHYSTENDVETIRASVCAPCHVSCATCQGPAPTDCL
TCPSHASLDPVELTCSRQSQSSRESPQQQRPGPPPEVQAEPRLRAGLLPSHLPEVVAGLS
CAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGR
GERTAFIKDQSAL
Download sequence
Identical sequences F7DHR9
ENSECAP00000017711 ENSECAP00000017711 XP_001502775.1.31192 XP_005602832.1.31192 9796.ENSECAP00000017711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]