SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001523098.1.59662 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001523098.1.59662
Domain Number 1 Region: 33-92,129-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.56e-38
Family BAR domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001523098.1.59662
Sequence length 345
Comment conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239]; AA=GCF_000149685.1; RF=representative genome; TAX=379508; STAX=36914; NAME=Lodderomyces elongisporus NRRL YB-4239; strain=NRRL YB-4239; AL=Scaffold; RT=Major
Sequence
MSFNFANFTKDLKSFGDRLTTDFNNEVLPLAQRTQRMVQEKIGKVNADDISQLPTEYIAL
AEKCNSIEKLYKNVLKITTNYENESYDYPLNLQESFTDFSQNITRRFSNLSKATTTAEAQ
AALIKPDETFKPPKTLYHALSRATDASVLTDGSGTGADEDYSQLASVAAGTTKSESSDPL
IKGLDLYSSSLKKIADARIGQDQLIKQKFNLPLQTTLRSLISQSNNIQRKVEQKRIDYDM
TRYNLTNCNNPAKESKLRVDMENAEDEFANTVEDAINIMQNVVENAKPLQEFLNLIQAQL
AYHKLASELLGSMVGDFENLIEEQNKLSAGSGHNQTGKESGEFEL
Download sequence
Identical sequences A5E7Q5
XP_001523098.1.59662 LELT_05644 36914.A5E7Q5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]