SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001523962.1.59662 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001523962.1.59662
Domain Number 1 Region: 58-170
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000147
Family FCH domain 0.027
Further Details:      
 
Domain Number 2 Region: 663-746
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000194
Family BCR-homology GTPase activation domain (BH-domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001523962.1.59662
Sequence length 998
Comment hypothetical protein LELG_04775 [Lodderomyces elongisporus NRRL YB-4239]; AA=GCF_000149685.1; RF=representative genome; TAX=379508; STAX=36914; NAME=Lodderomyces elongisporus NRRL YB-4239; strain=NRRL YB-4239; AL=Scaffold; RT=Major
Sequence
MSALFANSYWSADYISGLDSLKAQSATSINQLHEFRRLVFNYLKFHFSNSEYLDQSVKNL
YSSESPFYSKGNEKNEQLTFTSCYKSFVGAMEQESVTYQMLASNIDKQVLEDLTAYIKYH
EPKINREIDRLDELYEKYLSIMKQIMKYKQKYQDQIRLKEFAESSKTPTKTGLGLQGFGN
GDTLATKEDTDYSDDELYADDDSDILEQQQQEQQQQQRGQHKDKPAFDFPMKIGSAQIEN
TEELQKLISHLIEKTPTSKRGVPLPGFKNEMFVSDSLCDVLTRLRIKGMGPSRLNIEKFG
QSLADWKLITPTNIFLRKFKSEGVWFEWSDLAYSTATLTSTDCEMSKENIKSEENFPRST
TAAGTHRRMLLSQMAHSSLSFSSPTSSSSSSSKFVKDMSETTAKFNAMFSSMKNSMLKTN
HEELIVDSIQSYNENLLKFYETEYFLQKGLLEFAAYLEKFEKKKNQIMYDGSVKLLQIAA
KSYARQTANLERLTKTTTLMNIVENYEHDFLLTFEKFKTGLYMPITLSQQDNFKLLNQFL
PQNLKFSFDLFSDIPLQPTVLQTQAEPILLSTASIPILLYKIIMVLENKPINSNSDDNKR
KEEGDALVRTDLQELWLRPIDFQLQWRIKEQLTQLIANTLSVNPEDQNDVDVDLNAVNLI
IEELLKRSTAELVAFLKSWLLEIKDSIIPFIVYESIIKDYATSEDSNEAKNVKHRTALKK
LLSLIPRSNLASLIYILEHICKIFQLKALEGYGKFDDLPTSLSAESKEQEQIEHVSDKLN
LMEMVAAVPFIHLIMRPSSSKVSAGFKPPLAIYKKLLTDLLDLDVRSDLFKVLVENEKKF
REKKANEKIGGLSVKKIHVQDSVTSAPKIDLNGSTLYDDDEQHYDDNNDNSEEYKNGNGN
LNGNSNNKNNKKNSDIDVPVTPQRKDQSTLSNPEIKTPRPLSGGSFSLRPFKTRSTPAPS
PNASPTRHLRQVDEEITRAQSPNSSLLVPNLDIQFEGK
Download sequence
Identical sequences A5E586
XP_001523962.1.59662 36914.A5E586 LELT_04775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]