SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001524575.1.59662 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001524575.1.59662
Domain Number 1 Region: 162-283
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000783
Family UAS domain 0.081
Further Details:      
 
Domain Number 2 Region: 372-480
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000124
Family UBX domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001524575.1.59662
Sequence length 507
Comment hypothetical protein LELG_04547 [Lodderomyces elongisporus NRRL YB-4239]; AA=GCF_000149685.1; RF=representative genome; TAX=379508; STAX=36914; NAME=Lodderomyces elongisporus NRRL YB-4239; strain=NRRL YB-4239; AL=Scaffold; RT=Major
Sequence
MSLNTRIRDYFRNSSYHRLGTNESGSSSSGGVDDGSNSTTATTATNNGIIHNNSNNNNSR
SNNRNNNLPGAFPEEEVLPQPSRTAINSHTIRNSANRVNLWFSYIIIQPIILIMLIVFSV
LAKITNLLYINPSNLKARDDLVEEPVDKANKFVRNLEDNLPPLLDQGVNLPPFFQGSYTQ
ALYMATQRGKFLFVYLSNPNNENSSFIFDEIIINPKFTKIFTNSQLNNEVIIWGGDLTNP
EAYQLANSLNVTKFPFLGLLCLTRSTKMTPEGPQKEPAKMSLIGKIQGGNPLYVPPSPSP
SPSQPPSSSPVSRSQTHIGSNLIKNKFISKINKYEPELKLIRQELKDKYMTEVLKRQQEY
NYLQSVHKDMQKKAEKQQQAKTKAYLEYKASEFLNLNLELQAPNTAKIAIKFPDSTRKTF
YFPQNMKIDDIYIYVELYKRNMLQGKSRMSKITPAEAETMFENFQVKFNFKLLSPLPPRM
DLSNMRNEFIQNVDLVYPNGLLIVEDD
Download sequence
Identical sequences A5E4K8
XP_001524575.1.59662 36914.A5E4K8 LELT_04547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]