SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001524930.1.59662 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001524930.1.59662
Domain Number - Region: 65-197
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0178
Family IMD domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001524930.1.59662
Sequence length 229
Comment predicted protein [Lodderomyces elongisporus NRRL YB-4239]; AA=GCF_000149685.1; RF=representative genome; TAX=379508; STAX=36914; NAME=Lodderomyces elongisporus NRRL YB-4239; strain=NRRL YB-4239; AL=Scaffold; RT=Major
Sequence
MGTIGIPMLAEERENLLLKLSQQTKHLVAQKKTNYKLVIGIVFNEKIRPKIQVWFDAHHR
IYKGEGRIKTLFRFGKAKARTPEEYASWLLESLDQHIEVIEGELHPENFEITTPPLSISL
TCFLNSIKASFKKVFKLFLNLSKALRIAELGQSLINAKNKKLKKPEKLKKPKKRKKRKKR
KKKTRKKKGLRPKLKDTLILMLFQMLFILLILMLFLKLFLMLPLLLLHG
Download sequence
Identical sequences A5E2X5
36914.A5E2X5 LELT_03962 XP_001524930.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]