SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001581543.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001581543.1.43485
Domain Number 1 Region: 7-230
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.4e-73
Family Calponin-homology domain, CH-domain 0.0000555
Further Details:      
 
Domain Number 2 Region: 995-1100
Classification Level Classification E-value
Superfamily EF-hand 3.07e-16
Family Calmodulin-like 0.012
Further Details:      
 
Weak hits

Sequence:  XP_001581543.1.43485
Domain Number - Region: 253-368
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000547
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001581543.1.43485
Sequence length 1129
Comment actinin [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MSNNRGLLDDAWEQTQIKVFSRWTAKQLSFKGIPFDNVLEEFADGVKLIQLLEIVSKEPM
KGKWHKQPKMRVQMRENCGMALDFISSKNIRMVGIGSDDIIDKNKKLTLGLIWTIINKFM
IEEISVEEATARDALLLWAKKNTQGYKGVNVTNFTTSWSDGLAFCALINKFRPNMLDYDS
LDQTQQKENCEKAFAACKELGIYVFLDPEDLVGTQPDEKSVVTQVAEFFHFFAGESKTQA
AADKLKRTIGIQKAIEEEALNYEKQAQECLDVINTEREKLLAQDYDQTVPGVKSKLFNCI
KFGRVVRPVIVDKRGVAMKTWGQLVTKCNSNGRPIPQVKEELLPPNLNLKFEEIEKTASD
RRDELTKILEELQAKLIKAFDEAANAKIAVCDDINNKAINLTGDLYEQRDALNNYLQQAQ
EAAGTVKELQPQFVELVELRLNNRVKRTVIAVDGEFEQLIATIKRLIEGNKAAIFEYENK
KKIEEYNQAAQKYVDEVAQLKQDLEAIAGELREQRAANVDKSEEIIQKRNGVSDIRPMFQ
ELEKQSLHLGIENTPDAVTAMYTACLSQAQDKITQISKQLVDEYNEKAIAIHEKIGDVHK
TADSVSGTTQEKKDGVLKCQSDLTEIKASIQPTLEEPYQYLQSIKYSNAVKYTPNDLTRD
SDITFAFLTTLLNQLEEQLQSESNDARIAAYNELAKKYVDIANEFHQKVSTIDGDRATRR
NAYLSAQLELGNKREGLSQLKPEYEALERDTLHIRVNDSPATISKVYANALQIITDKLAE
IYNEMVADFDAQVLAIAEKVKVVQNVELTGTLLELKDKIAQSKAQAQEILPELPTLDAPW
EDLCDFNLNYRVKQTPENLRATLEAVIAFLNHQEESNNEKLASEGRESRIFAYNQKAAVS
VALARELEQKVSNVDGTLPEKQQKLFDIKQEVIDGDEAAKELTPIFEDLEKDELHLAIED
TPDSIAAFFANILSHIDGLVREIDTAIAAEKGLQISEEQLTEFRETFNHFDKDHTNFLQY
FELRACLTALGDDISDDQAKEVCKKYSATGEEKLNFDEYVKFMLDHFSKAENADTTAKAF
KAIANNNPILTDAQLDQYFKGEEAEYLRKVLKQVDGGYEFAEWVNSIYA
Download sequence
Identical sequences A2DGG1
5722.A2DGG1 XP_001581543.1.43485 88273.m00344 gi|121915771|gb|EAY20557.1| gi|154417044|ref|XP_001581543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]