SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001616716.1.43797 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001616716.1.43797
Domain Number 1 Region: 139-169
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001616716.1.43797
Sequence length 186
Comment hypothetical protein [Plasmodium vivax Sal-1]; AA=GCF_000002415.2; RF=representative genome; TAX=5855; STAX=5855; NAME=Plasmodium vivax; AL=Chromosome; RT=Major
Sequence
MFPGGDSQLFNFGGPERNEGGDPGEELQNETHRRLINFPTSLNANFARPVLDFQKIEPSY
FLTNDLSRRPAGGEAAWEKEEEGGPREEITFEKEVDEEREHKKRITLFDLSEEQKEKVKH
FKIKKVLQNEVYLKKNKILKYLVHMFVCDLLREKPDDIYEFAACYFTHPQLRQSVARRLR
GMIGGP
Download sequence
Identical sequences A0A0J9SM22 A0A0J9T7H2 A0A0J9UYI4 A0A0J9WA01 A0A1G4HIM3 A5K0Z2
gi|156102046|ref|XP_001616716.1| gb|PVX_085250 XP_001616716.1.43797 5855.PVX_085250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]