SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001618170.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001618170.1.94760
Domain Number 1 Region: 13-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family Laminin-type module 0.0035
Further Details:      
 
Domain Number 2 Region: 142-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000977
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 3 Region: 92-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 190-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  XP_001618170.1.94760
Domain Number - Region: 62-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family Laminin-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001618170.1.94760
Sequence length 239
Comment hypothetical protein NEMVEDRAFT_v1g155465 [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
MAISNEPFRSPACSCDPLGSRTLSECEPYGGQCRCKPGVEGRDCGRCKPGFYNMTSEGCR
PCDCKGPNSVCDPVSGECECPANTVGRTCEPCQCNNSTDKCLRSGECRDCQHNTTGFYCD
KCVTGTYGNATAQQCKGKQISCDCNVNGSSSSLCDHVTGQCSCKENVVGRDCSRCKVSSY
GFGPAGCTECACNVHGSASLQCDDSGVCPCNLEVIGTKCTQCKTGYFGLPKMACKGKLR
Download sequence
Identical sequences A8DVA4
45351.JGI155465 jgi|Nemve1|155465|e_gw.8623.2.1 XP_001618170.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]