SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001620567.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001620567.1.94760
Domain Number 1 Region: 117-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000519
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 80-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000448
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 3-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000634
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 4 Region: 41-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000088
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001620567.1.94760
Sequence length 158
Comment hypothetical protein NEMVEDRAFT_v1g147756, partial [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
NLCEPNPCLHKAVCQYSEDKHDYTCVCPGHFTGKHCGPSNQKCPYNTCLNGGTCVIERGA
EVCYCKSPYYGDKCQYLFCKEARPCKNGGTCVDTGPKLYACRCAPGYTGKNCTVEPHCLP
HPCKNGGRCIERQYGYDCQCDVRYTGPHCEGEHNQPVL
Download sequence
Identical sequences A7T6D8
jgi|Nemve1|147756|e_gw.2123.6.1 XP_001620567.1.94760 45351.JGI147756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]