SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001621937.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001621937.1.94760
Domain Number 1 Region: 105-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000177
Family EGF-type module 0.008
Further Details:      
 
Domain Number 2 Region: 58-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000921
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 3 Region: 19-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000021
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 4 Region: 2-23
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00005
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001621937.1.94760
Sequence length 141
Comment hypothetical protein NEMVEDRAFT_v1g143133, partial [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
DTYTCACLQGYTGRHCETDINECQSNPCLNGATCTDHVNGYTCSCKLGYSLHLLCFLDIN
ECQSNPCLNGATCTDHVNGYTCSCKLGYTGIVCQQGKHICFMLTNINECQSNPCLNGATC
TDHVNGYTCSCKLGYTGIVCQ
Download sequence
Identical sequences A7T2I1
45351.JGI143133 XP_001621937.1.94760 jgi|Nemve1|143133|e_gw.748.16.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]