SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001624332.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001624332.1.94760
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000789
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 80-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 35-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000573
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 120-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000305
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001624332.1.94760
Sequence length 154
Comment predicted protein, partial [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
CNDIECQNNGTCFATDTDYGCTCLPEFTGSRCETHNIKLCDSSPCSNYSVCNNSEDGLNL
TCTCPPGYTGRHCESGIPRPCDSNPCSNNSVCNNTQGDRNYNCTCSPGYTGRHCDTLKQT
LCEENGCQNNGTCFWNDTDYGCMCVSGFTGSRCE
Download sequence
Identical sequences A7SVM5
jgi|Nemve1|52064|gw.334.30.1 XP_001624332.1.94760 45351.JGI52064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]