SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001631337.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001631337.1.94760
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000024
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 2 Region: 62-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.05
Further Details:      
 
Domain Number 3 Region: 111-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 4 Region: 166-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001631337.1.94760
Sequence length 208
Comment predicted protein, partial [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
CIPCRCNGHSNECDPETGECINCQDNTAGDRCQFCVKGFYGNATIGKPGDCQLCKCPLGT
SSNSFASECNVRGDGSLECLCREGYTGDQCEQCADGYYGDPSVPGDYCKKCDCNGNIDPD
VSEWALCNPFTGVCNRCTNKAAGDRCERCRDGYYGDAVVAKNCAKCECSACGAVTSVCNH
TNGACQCKANVIGPNCSTCKVSHVAQWE
Download sequence
Identical sequences A7SAG7
jgi|Nemve1|111045|e_gw.103.86.1 45351.JGI111045 XP_001631337.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]