SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001688482.1.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001688482.1.40869
Domain Number 1 Region: 26-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.89e-54
Family BAR domain 0.0000000569
Further Details:      
 
Domain Number 2 Region: 287-356
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-17
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001688482.1.40869
Sequence length 357
Comment AGAP005076-PB [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
MAENKGMLLAKSVQKHAGRAKEKLLQNLGKVDRTADEIFDEHLTNFNRQHTCATRLQKEF
SNYIRCVRAVQNASKSLMEAITEVYESQWTGSEVLYGQAKTIDTQYQQFSYKLADQVLKQ
LDTYALQFPEMKKKIDKRGRKLVDYDSQRHSFQSLQANAAKRKDDLKVTRGREQLEEAKS
TYEVLNSELHDELPALYDSRILFLVTNLQTLFACEQQFHSETSKVYAELEAIVDKLATES
QRGSYTLKKINANSNPSSPQQSPVKANLSIVNNVTNGSANANGRAATTDLPPGVLYRVKA
TYKYVREDVDELSFEVGDVINVVEYEDPEDQEEGWLMGNKEGTNEKGMFPANFTRPL
Download sequence
Identical sequences A7UT63
AGAP005076-PB AGAP005076-PC AGAP005076-PB|hypothetical AGAP005076-PC|hypothetical XP_001688482.1.40869 XP_001688483.1.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]