SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001696422.1.80978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001696422.1.80978
Domain Number 1 Region: 287-362
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 198-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.74e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 122-190
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0009
Further Details:      
 
Domain Number 4 Region: 479-509
Classification Level Classification E-value
Superfamily WW domain 0.00000000356
Family WW domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001696422.1.80978
Sequence length 511
Comment C1, subunit of the circadian RNA-binding protein CHLAMY 1 [Chlamydomonas reinhardtii]; AA=GCF_000002595.1; RF=representative genome; TAX=3055; STAX=3055; NAME=Chlamydomonas reinhardtii; strain=CC-503 cw92 mt+; AL=Scaffold; RT=Major
Sequence
MADHEEPPPGTYDGEERAPDVETGNSHLPPPPELHAAPQEHGADQGAVLDAGRSRAEMLA
AIFAAQAGANVVPSDPTGHKRKLDDDEYHDAPDSKRPASMAFGDGSGALPPPPPLGADAP
VAMETIMCPPDKVGRVIGRAGATIRDLEASTGTRIQVDHKAPGDKPVTISGRADEVERAK
RQVLDLISGHGSDAAPAPGEAQKTLECPQGIVGRVIGRGGETIRTLQQASGAHILVNQDF
PEGAARQITISGSQDAVDRAASMVQELIGGEHANTSQVVQRFGVGSTEVLECPKTMVGRI
IGKGGETIKDLQKRFNASIQIDQSAMPCKVTITGPSHTIASARRAIEDLIRSTGPPPGGM
GMGGGSRPPYGAPYGQQYPGGAGGYGGGYGGYGAPGGYGAPGGYPGYGGYGGYPGGAPYG
GYNAGGYGAPGAQSSDPYGAGSSSYNYGGAGGGSSSAAPGAPGSTPAAPGTNGSGSGGSS
PWQALQDDQGRTYYYNSTTGVSQWERPADMP
Download sequence
Identical sequences A8HYR6
XP_001696422.1.80978 3055.JGI182403 jgi|Chlre4|182403|estExt_fgenesh2_kg.C_30171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]