SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001734004.1.18373 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001734004.1.18373
Domain Number 1 Region: 14-240
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-73
Family Inorganic pyrophosphatase 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001734004.1.18373
Sequence length 244
Comment soluble inorganic pyrophosphatase 1, chloroplast precursor [Entamoeba dispar SAW760]; AA=GCF_000209125.1; RF=representative genome; TAX=370354; STAX=46681; NAME=Entamoeba dispar SAW760; strain=SAW760; AL=Scaffold; RT=Major
Sequence
MSITSIVPNFGTVRTESVGTLGKKDYRIYFEQEGKKISPWHKIPAFVSKEVVNMVCEIPR
GTNAKMEISTTTKFNPIKQDLNKDGSLRYMKHGNVLNHYGAVPQTWEDLFERDSIVGIPG
DNDPIDIIDISQKKVARGEIIQVKPICALALLDGGETDWKVIGINVNDPLAQTIKSANDI
EKTVDEIREWYRVYKVAEGKKLNKYAYGGKAFNQKSTLDIMNETHLQYRKLKTTQKKLSK
LALD
Download sequence
Identical sequences B0E6I6
XP_001734004.1.18373 gi|165904693|gb|EDR29881.1| gi|167376454|ref|XP_001734004.1| jCVI|EDI_348910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]