SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001738222.1.18373 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001738222.1.18373
Domain Number 1 Region: 124-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.83e-61
Family RecA protein-like (ATPase-domain) 0.0000000169
Further Details:      
 
Domain Number 2 Region: 41-107
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000011
Family DNA repair protein Rad51, N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001738222.1.18373
Sequence length 365
Comment DNA repair protein rad51 [Entamoeba dispar SAW760]; AA=GCF_000209125.1; RF=representative genome; TAX=370354; STAX=46681; NAME=Entamoeba dispar SAW760; strain=SAW760; AL=Scaffold; RT=Major
Sequence
MSAKQMQRSSEEELLESEENLKEKEKANEEEHEEEEEEEEEENAAVPIRKLIGLAGITEG
DCKKLEEAGFFTVQSIAFTPKKQLITIKGISDAKADKLLAESSKIVPLAFTNAAELNNLR
KETIRITTGSRELDKLLCGGFETGSITELFGEFRTGKTQLCHQLCVTCQLGIENGGTEGR
AIYIDTEGTFRPERLTQIAEKYGLNSEEALNNVAVARAHNTEHQMQLLQMASGLMAKERY
GLLIIDSATALYRTDYSGRGELASRQMHLAKFLRALQRIADEFSVAVVLTNQVVAQVDGQ
ASMFGGDTKKPVGGNIIAHASTTRLYLRKGKGEARICKVYDSPCLPESEASFAITTNGIE
DVKDD
Download sequence
Identical sequences B0EJ35
XP_001738222.1.18373 jCVI|EDI_329980 gi|165898654|gb|EDR25461.1| gi|167387582|ref|XP_001738222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]