SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001745062.1.20067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001745062.1.20067
Domain Number 1 Region: 25-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-57
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 358-413
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000212
Family Thioltransferase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001745062.1.20067
Sequence length 414
Comment hypothetical protein [Monosiga brevicollis MX1]; AA=GCF_000002865.3; RF=representative genome; TAX=431895; STAX=81824; NAME=Monosiga brevicollis MX1; strain=MX1; AL=Scaffold; RT=Major
Sequence
MATPDMAAAAAAAAGSVSGLNKKSEGWVEIQRGTFTNWLNTKIKDKMPEIDENDLANAMQ
DGVCLIEMLQTVSGKSMGKFNRNPRLKVHKLENLTASFDFMKKENLTLVNIGPSDIESGN
EKLILGLLWTIIYHYQIAVSFKGSDGKAVSGHGKKGGARELMLEWVRSKIPEYNIKNLNK
DWNDGRAMAALVNVIAGEPQVIPNHGEMLVENAKRNATTAIDAAEEYLGIPKVLEPEDLV
NPDLDELSMMTYLSYFKTATRKSNDNQAVAEPEPEPEPAAAEPEPEPATPAKAGGALPPP
WERSADWREYTGVNLGGRCKIRVYFSLTTSSAVYRKRKEEMMALFERMKVHERPDFEPWI
PVDMDMDKATRDAIFEKAGTRELPMLFVDDEYVGGYDQVMDLNESNQLEKIFEY
Download sequence
Identical sequences A9UWY0
81824.JGI36696 jgi|Monbr1|36696|estExt_fgenesh1_pg.C_70160 XP_001745062.1.20067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]