SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001746019.1.20067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001746019.1.20067
Domain Number 1 Region: 392-596
Classification Level Classification E-value
Superfamily Bet v1-like 1.01e-31
Family STAR domain 0.015
Further Details:      
 
Domain Number 2 Region: 89-191
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-18
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001746019.1.20067
Sequence length 607
Comment hypothetical protein [Monosiga brevicollis MX1]; AA=GCF_000002865.3; RF=representative genome; TAX=431895; STAX=81824; NAME=Monosiga brevicollis MX1; strain=MX1; AL=Scaffold; RT=Major
Sequence
MPDKEAAFAASASSEGRGSRKSTPGHSGRTSPLLTTTSHPAPRRYSNLHKRSISDVVASH
SYDFVQHDDDSVGAHSDTELDGRDREPPLPSREGQVAKWTNYIHGWQERYLVLRDGTLSY
FKSAQERTRACRGSIDVIGAVIKAHDFDALRFDVVVGADQLFYVRATSTAERDAWVADLR
LTKDLLPDRQPSALSRRPSTFSLASGTSANSAHVGTSNGPRIFKDKLAELKSIQSALGKQ
ALSLHTNLQQVVDEFGEESSEGSRAREAAEEAVLFKVAAQGTMSAIEETIALLIKREEDL
HRRYERERQKRKQLEEELDTRPDMRNLGPDYVEGPHTLLNDDEFYDALETGLDQLEAQER
HRQEEEARLESQRAQQSALPSRKTHRFTGLVDEQLQHSLALADEDVDAHWALGYQEGQLK
VFRRESAESGTPTDRLKAFHYIPGISGRELAEYFFNTDYKTEWEHTIESFRVLEFLDQHT
NVTHMIHKRVWPSAQRDSCFVSHFCHINEHRWAVLNYSVDHDMAPQDKFVRLTCAMFLLC
DTDIQSRDTPQSRKDVGCRITYVASINPGGWAPPSVVKAVSQREYPKFLKNLEKHVLKHY
EGKPLSV
Download sequence
Identical sequences A9UZX1
XP_001746019.1.20067 81824.JGI32502 jgi|Monbr1|32502|estExt_fgenesh2_pg.C_110017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]