SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001760481.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001760481.1.60028
Domain Number - Region: 99-193
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0311
Family Calponin-homology domain, CH-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001760481.1.60028
Sequence length 403
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MDVPQDELPLLYTWSLVGLLGPYPKAKRAAHALIRQQFICRGMPGEVLGEPVLDPMISLA
GCVSVCPVRHGYGILWINKNVNVRVEHVMSWPFVAHITLNQIDGIPLSRPKRNISRDFSD
AVLAAEVVAHYCPRLVDVHNYSAANGLAQKIYNWSTLNNKVFRRLHFTLTKEDIEAVASC
EPQMIERILKLLKYKIAKYRPNGLNGDSDPVKEPSDGGHCHEFHDHRSTRHPNPQRELFP
RFGQTQQSQVKDVVSQGQEYLPEPECTKRNMWVGRRGSQEQYSTSRTSSPHRGCNSQELG
LMNAKLEEKNIYIRELGETIELLEAKVRKLEQLLRLKEHKIQVLSGKIPKQNVVTSVRYN
SLNAKEHFELDIDLESYWDRLTLAAAVVDRQSGLLDMCACLSK
Download sequence
Identical sequences A9S296
XP_001760481.1.60028 jgi|Phypa1_1|73629|fgenesh1_pg.scaffold_42000187 3218.JGI73629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]