SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001774663.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001774663.1.60028
Domain Number 1 Region: 448-745
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-75
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 61-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-23
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001774663.1.60028
Sequence length 799
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MTTRIVAQSASLDAQSFGLNATLGGNQTWLSENGTFTMGFYPIPANSSSLYLAVWYSGVP
VAPVWLMNRERAVKSGATLTLNNAGSLVLANADGSSVWTSNTSGVGVVGGKFLENGNIVL
RNSSNWTMWDSFDYPTDTFLPGLIVMGHKFTSWRTNSDPSPGLYTFEMLADGQLYFKWNG
TETYYNSGPWGGSYFTNPPQLGRTTSPDVFHFDNSTGSPRFYYNTSGRSATADISLKRMR
LDPDGVARQHIWVIDSNSWQTFISAPVEPCDSYHVCGKNSLCISSNYIPGCTCLPDFRPV
SAAEWSDQDYWLQGCGRDPALLGSCTTNASIANSTSDFSFMALAGATIEVNRTSPPQFFF
NDTESACRERCAGNCSCGSFSFSEVAPGTSTATNCDNNGSSFNGAKLIITVVIVCCVVVA
VAASLLWWLCIRRRDAKRRADAAAAFSVVGLARFTYKELVDATGNFGHQLGSGGFGTVFQ
GTLPDKSEVAVKTLNKLRQGEQEFRAEVAVIGTVQHINLVQLRGFCAEGDHRALVYEYIP
NGSLEKYLFRRVAGKGDGPQDVNNVMDWRTRMAVALGAARGIAYLHHECRSSIIHCDVKP
ENILLSGDFTPKVADFGLAKLMGKDVSRLITNIRGTRGYLAPEWLTNCTLTSKVDVYSYG
MTLLEIISGRRTVDLSYPADKWFYAVWAYKEISKGRDLTSLVDDRLAKGSVDAEELRRAL
HVGLWCTQDDPVKRPNMRDVEKMLEGVLDVNDAPAPPSYIAQTDEACNSGDSKIASTDEK
GSQLMNGISFEYTQTFSGR
Download sequence
Identical sequences A9T7Y0
jgi|Phypa1_1|141554|e_gw1.180.26.1 XP_001774663.1.60028 3218.JGI141554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]