SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001807060.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001807060.1.52716
Domain Number 1 Region: 562-753
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-31
Family Fibronectin type III 0.0006
Further Details:      
 
Domain Number 2 Region: 717-851
Classification Level Classification E-value
Superfamily Fibronectin type III 5.96e-17
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 3 Region: 371-542
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000985
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 4 Region: 137-248
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000326
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 5 Region: 236-354
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000962
Family Fibronectin type III 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001807060.1.52716
Sequence length 1100
Comment PREDICTED: cytokine receptor [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MDLKRWGHFYMKVFLLFGTGGLVLAMEPMCSPGLDFGGYTVPQGDIVIEYGNPLDIICVL
LNNSKNILGPDASLNLSFVRNQDAVPPEMIEVINSTAIKLHIDKPPKVSSDTYSCLQYNK
SAVCMNCVTVGTKPQPVTDFECISYNYDNLTCTWTPPENYIKTTYNLTFTLGGRAARYIQ
ACPHIDYSEKTKRMSCMWNVSTTPQYRQVHEVYNFNLTMENKFGTHRQSYPFQHFAHVLS
GPPENLTVINTTSSSIYLYWMVPLSMRTFWPGVHHRILYQCEYYEKKWHFGGEIKENPKR
YEIYFNLTNLKYAHALCDIRVSLRSAKALPSDESMWSNNASITVWTSSKIPDEPPETNVG
SFEVVAFGNSLQNREAYVYWKQIKEEQKNGPDFHYGIAVEGEPAIRPVEFTNTYAKFENL
SISTSYTFNIWSENSNGTSARKSSVFIPKQTDRIKEPWSFTKVEFGDGVYELTWVAPKLL
DNQYITNYTIFSCSNERDRPYQCNGMLNWTVVSSNTTSKTMIVEKNKIFQFAISANTHNG
SSGMLWASCTVIHNKNMGKMKNVWINSVGSTFIEVGWKLDCADRIGSVEGYVVYYCPIKS
PMHTECKAPQANRTFDGTSMLSSGNITDLNPYTTYMLTVSVKTKHTTFSQQSDPLYNTTL
EDAPSTPPRDVTIQKVTNSSIRVAWKPPEALNGIIRDYVVYCCVKGSLCEKIPVKTELNY
TITGLKSFENYSIELEACTTKCSGKSERLQVTTSMGYPSKIRKPTVDLRNDTSITIVWNE
PEEPSGRNDYYVVQFRQKHKSENKTFQYNTTKRKFVIENCGDGGKFNAFYISVKAVNKID
NRSYDGPWSDELENYCETPINYIMYLLLFVAIVAVVSVGFFSTRLYNHCKFMRDVEVKLP
PGLAPVVADHTLVPWSTEKRQDPGDSHSPPDEELLLVKMSEGRHFSGDSSGCSSGHESVT
SSLESGTHISSSSDSGTEQPAAYSVMEASSDTPYISVTGGSEASSPYVMTGDAVKTINPG
YIPFTQPPDFGGGLDAKGDSPYISVTATDATKMGYKPSSEVSDESSPYVMTGDAPKTINP
GYIPFNQTEPMKNSYVHITF
Download sequence
Identical sequences D7EJN5
XP_001807060.1.52716 TC001874 7070.XP_001807060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]