SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001835009.1.59657 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001835009.1.59657
Domain Number 1 Region: 254-341
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000246
Family Thioltransferase 0.05
Further Details:      
 
Domain Number 2 Region: 458-537
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000413
Family UBX domain 0.084
Further Details:      
 
Weak hits

Sequence:  XP_001835009.1.59657
Domain Number - Region: 43-90
Classification Level Classification E-value
Superfamily UBA-like 0.00408
Family UBA domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001835009.1.59657
Sequence length 652
Comment hypothetical protein CC1G_09900 [Coprinopsis cinerea okayama7#130]; AA=GCF_000182895.1; RF=representative genome; TAX=240176; STAX=5346; NAME=Coprinopsis cinerea okayama7#130; strain=okayama7#130; AL=Contig; RT=Major
Sequence
MLPSIEPEPLCREATAKSDCGSKERVGGWRRVWYYGVVEFEMDGLSESQQAAVIQLRELT
NGGDDEVAIGVLRSVNWDVGRAADLVFGGTGVGQAPPAPNSDTERHAFTVDDSEQGFTYD
HQSSSLSTATRPILTILSFPFTLLSSIFRFIFNVLRIPFPSLGRFVGLTFYSPLNRNASR
RGHGSGGPDRWIRELEEETGAICIGRLKASKGVSSGRDNDRGEAGPSGPSSSTLSSRAAA
SGGDGIFEDGRLVLPDFVGGTYEGALKTCQREYRVGCIILVSEEHDDVAEFKRSTLTDQT
FVKTLHDNNVLVWGGDVRDREAWSASEKLQATTYPFVAFVALQPRRTVGNSSSSRSTPPS
LTVLSRHQGPSTPSRNATGPTSAQTLTAHLTTQVLPRVTPYLAGLRSAQLEIERARQLRE
EQDRAFQDSARRDTERIQRLMREEEERKREEQRLLEVKQREEKERKRAEEERIKKEEERM
EWRRWTRKALRDREAITDGKPLRLAIRLPNGTRTVSQFTSRDTLTTLYATVDAQLVPSHL
SPDDDPASPPSPSNPGSSLEETLESLIPSYSASTSTTSTQSYFNFLLASSYPRTELPWSP
STPLSSVPELKGGGQLVVEMVTDSGRSSRASSRANGAGNGGDDSDEYDTEED
Download sequence
Identical sequences A8NMY1
CC1G_09900T0 XP_001835009.1.59657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]