SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001843350.1.94360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001843350.1.94360
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-42
Family Calponin-homology domain, CH-domain 0.00000304
Further Details:      
 
Domain Number 2 Region: 192-249
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000183
Family EB1 dimerisation domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001843350.1.94360
Sequence length 250
Comment microtubule-associated protein RP/EB family member 1 [Culex quinquefasciatus]; AA=GCF_000209185.1; RF=representative genome; TAX=7176; STAX=7176; NAME=Culex quinquefasciatus; strain=JHB; AL=Scaffold; RT=Major
Sequence
MAVNVHFTSCTTENLSRNEILAWVNRTLLSDFRKIEELCTGAAYCQMMDILFPGCVPLKR
IKYCTNLEHDFINNLKLFQNTLVAMKIDKAVPIDRLVKGRFQDNFEFVQWFKKFFDVNYD
GKEYDPQDARNHAPMGYGTPNTLKPSQRTNIAGGAAPKPGGITRNVEKKTTPTTALGKLK
ISETNNVLKEQFNALTQEKDDLTVRMQTVEMERDYYYQKLTQIEALLSEEATDENQDFCE
RAKEIMFAEN
Download sequence
Identical sequences B0W3R6
XP_001843350.1.94360 CPIJ002082|microtubule-associated 7176.CPIJ002082-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]