SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001846676.1.94360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001846676.1.94360
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-25
Family SPRY domain 0.0041
Further Details:      
 
Domain Number 2 Region: 114-149
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000471
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001846676.1.94360
Sequence length 171
Comment SP555 [Culex quinquefasciatus]; AA=GCF_000209185.1; RF=representative genome; TAX=7176; STAX=7176; NAME=Culex quinquefasciatus; strain=JHB; AL=Scaffold; RT=Major
Sequence
MMFGIGTKKARLHVNAFTNLLGEDKNGWGLSHKGLLWHGGIARNYTKRFKENQATRIGIL
FDGVAGTLTYYKDDVCLGIAFRGLNEIREPLYPVVCSTAAKTEMVLTESRRDFVNLQDRC
RAVIIKHIKTREKLDRLNLPYCITNYLAEALSDCTTPVTPLEQQLIDYYLF
Download sequence
Identical sequences B0WDA8
XP_001846676.1.94360 CPIJ005298|SP555|protein_coding|supercont3.83|251913|252495 7176.CPIJ005298-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]