SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001865413.1.94360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001865413.1.94360
Domain Number 1 Region: 165-263
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000034
Family Insect pheromone/odorant-binding proteins 0.0055
Further Details:      
 
Domain Number 2 Region: 25-97
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000114
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001865413.1.94360
Sequence length 313
Comment D7 protein [Culex quinquefasciatus]; AA=GCF_000209185.1; RF=representative genome; TAX=7176; STAX=7176; NAME=Culex quinquefasciatus; strain=JHB; AL=Scaffold; RT=Major
Sequence
MNFVGISSLVIVAFFAGGNAAWKPFSPEETLFTYTRCMEDNAKGDLALAKKWMAWKLEAD
QKSACYAKCVLVGLELFDESSKTFKGDHIVEQYQKYKSYTSQDEAGVKKFQQAVQALGTI
DSANCLKVLQKYGPVHAQFTDVQRNVYFGKKEITDKIYNSDYTVKKRDETMFRFCERSNF
KDGSEELCTLRKTGITTNNNHLDCLFRGLRYLDRNGNINPDEIKRDLHFINVKDKDAAVD
NALNNCKVKEATKATDYNDCLWKDPNLKDIMMPVFDYREVRSESYRYFIENTDPYDVAKV
KEKVKKYDKDAGC
Download sequence
Identical sequences B0X6Z1
CPIJ014551|D7 XP_001865413.1.94360 7176.CPIJ014551-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]