SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001873590.1.58555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001873590.1.58555
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.81e-34
Family Thioltransferase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001873590.1.58555
Sequence length 108
Comment thioredoxin [Laccaria bicolor S238N-H82]; AA=GCF_000143565.1; RF=representative genome; TAX=486041; STAX=29883; NAME=Laccaria bicolor S238N-H82; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MPVKTFSSFDDFKAVINGEKPVVIDFWATWCGPCRVISPVFEKLSDDLSFAGVEFYKVDV
DEQDQISQEVGVRAMPTFALFRKGEKVSELVGARPQELQSLVAKALTD
Download sequence
Identical sequences B0CNZ5
29883.JGI181679 XP_001873590.1.58555 jgi|Lacbi1|181679|estExt_GeneWisePlus_human.C_11084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]