SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001876550.1.58555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001876550.1.58555
Domain Number - Region: 102-214
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000121
Family Thioltransferase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001876550.1.58555
Sequence length 346
Comment predicted protein [Laccaria bicolor S238N-H82]; AA=GCF_000143565.1; RF=representative genome; TAX=486041; STAX=29883; NAME=Laccaria bicolor S238N-H82; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MKLATLGLLACALFVNAQYISEGWKPGQKVHTITDAASADPTYTPKPVVETQPKQSKPLR
LSQLFDINRLLTSDPAVAVFSKFGINITEKIQLAFTNKLWDERIPLITDHNYKDIIVNEQ
LTEQEEKDRVWMIVISSTSSKQEGVSKFLDEVFDNAYNETQVAEDLPNVRWGRIDYLNVT
HITTKWNVWQAPYLVILKDRGQTLRFYRPQHLRLRSDSLREFLAQEGWTATAPWNSIWGP
GGEREWLMDHFATVLTKIYNWTVVVPRWILLLLSGTVGSILINLMHKPGKQTAQAIEAQK
RSQAQEKQSVEKESGPVSAPATDSEDGTSAHALKRTTAKQRMRPEA
Download sequence
Identical sequences B0CXL9
XP_001876550.1.58555 29883.JGI292766 jgi|Lacbi1|292766|estExt_fgenesh2_pg.C_40333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]