SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001876637.1.58555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001876637.1.58555
Domain Number 1 Region: 4-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.1e-69
Family Glutathione peroxidase-like 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001876637.1.58555
Sequence length 224
Comment cysteine peroxiredoxin [Laccaria bicolor S238N-H82]; AA=GCF_000143565.1; RF=representative genome; TAX=486041; STAX=29883; NAME=Laccaria bicolor S238N-H82; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MPSLRLGNTAPDFEAVTTAGPIKFHEWIGDSWAILFSHPGDFTPVCTTELGEVARRGPDF
ANRNVKVIGISANGLEEHHKWVKDINDYGSKVAPTDVQFPIIADPDRKISTLYDMLDEQD
ATNRDAKGLPFTIRTVFVIDPKKVIRLTLAYPASTGRNFDEILRVIDSLQLGDKHRITTP
VNWKKGDDVIVHPGVTNDEAKTLFPDYSQHLPYLRTTPLKVEKD
Download sequence
Identical sequences B0CY32
jgi|Lacbi1|172363|estExt_Genewise1_human.C_40887 XP_001876637.1.58555 29883.JGI172363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]