SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001880324.1.58555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001880324.1.58555
Domain Number 1 Region: 83-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.01e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.00035
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.29e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001880324.1.58555
Sequence length 215
Comment predicted protein [Laccaria bicolor S238N-H82]; AA=GCF_000143565.1; RF=representative genome; TAX=486041; STAX=29883; NAME=Laccaria bicolor S238N-H82; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MVIKLYGAVNSTCTKRVAIVLHEKKVPFEFHSIDFSKAENKSPEYLKKQPFGQIPYIDDD
GFILYESRAISRYIAEKYANQGTPGLIPTELKAKAIFEQAASVEKDNFDTFAAKAVYENT
FKPFYGLTPNKAVFDELIATLDKKLDVYDQILSKQKYVAGEEITLADLFHIPYGAILPAA
GSNVIENKPNVDRWFKDITSRPSFLAVKDGVKSSS
Download sequence
Identical sequences B0D843
XP_001880324.1.58555 29883.JGI184665 jgi|Lacbi1|184665|estExt_GeneWisePlus_human.C_100346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]