SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001892317.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001892317.1.25112
Domain Number 1 Region: 117-308
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.13e-48
Family Astacin 0.00014
Further Details:      
 
Weak hits

Sequence:  XP_001892317.1.25112
Domain Number - Region: 380-457
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00011
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 
Domain Number - Region: 306-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000571
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001892317.1.25112
Sequence length 468
Comment metalloprotease 1 precursor [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MFYSAVPRVPLALIALISWLCHISPAMIIPALRNEHPENVPDKMAIGKEPIDNNSDRMSP
TGGTFNQYLGNNIRLFEGDIILTKQQEKIWNQTFNYAMTFSNRTIRMGRKKRQAYRSDNY
FWQDGIVPYRIDSKLSQHAKDIIKKSIEKWESSTCITFIPASNKKNALVFVRGSSCSSYI
GHMSQWTKQPVSIGYNCEHIHTISHEIGHALGFLHTHTRADRDEYIWIKFNNIQDGLSSN
FMRSSREDNYNYGLPYDYGSVMHYSKKAFTSNSGPTIIPRYSWYEDTMGSGTGPTFIDIL
MMNTHYKCLGQCKNNIRCMNNGYQHPRDCYSCLCPSGYGGRYCERRADSFGWGGNLRATS
EWQILNAKMGKSGFYSDDISYCHWWIEAGQHEIIEMEITSLSGTCSEGCIFGGLEIKAVA
DKRLTGYRFCCERSNGKIVKANGPILPVILFNRRDYTQALIRFRLKKT
Download sequence
Identical sequences Bm1_04145 XP_001892317.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]