SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001893006.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001893006.1.25112
Domain Number 1 Region: 342-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family Merozoite surface protein 1 (MSP-1) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001893006.1.25112
Sequence length 422
Comment EB module family protein [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MIRHLWLFLFIKQVYSNFTPCNGKSPLGGTCDWNIDCENKGSICLRGRCRCHPHYTEIVD
DKRGGNPYCKRLPAKVGQMCTTKCREPLFCRSGQCQCVQRGTTTLINGQCISMSRVGDRC
TRHYDCSAPFSACLNSQCVCISGTIQQGSQCIAKSACPLGGIPGNACIRKANQHMVENFV
DGADDCPPGQICITIGESPMGHCCPKVCPLGTLPEYNYSCDPTSNIRCPSDTHFCHRISD
GGFSQSLCCRRPCNAMAPKALYINGICMARGQLNSQCTANEQCGGGEGMICNRGQCECLA
GFHPLVDPVTHPLRNPSQTCTRDCESEALSRDTTCLKPVALQGHCFIQKQCPINSGCYRG
RCQCKCGFKQEKQRCVELPPSPTTTRQPSVIVPGTVIVPGGDFLSLIGNFFGRTGARNAI
GR
Download sequence
Identical sequences Bm1_07680 XP_001893006.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]