SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001893050.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001893050.1.25112
Domain Number 1 Region: 63-106
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 8.5e-16
Family Transcriptional factor domain 0.01
Further Details:      
 
Weak hits

Sequence:  XP_001893050.1.25112
Domain Number - Region: 5-45
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00575
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001893050.1.25112
Sequence length 109
Comment hypothetical protein [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MLSEFCSECGTVLPIPATAPVTITCSYCRTQWHIKPIRNKLVYRSEKVYQNRVLNANEGA
LENPVVDKICDKCGHGKMSYACRQTRSADEGQTVFYMCLKCNYNMVENA
Download sequence
Identical sequences A0A0R3QFB7 A0A1P6BUA4
XP_001893050.1.25112 Bm1_07900 Bm2231 Bm2232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]