SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001893134.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001893134.1.25112
Domain Number 1 Region: 76-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000667
Family EGF-type module 0.034
Further Details:      
 
Domain Number 2 Region: 20-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000671
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001893134.1.25112
Sequence length 128
Comment EGF-like domain containing protein [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MVLINVALALLNCLVVLPSCFDPAKLCLNGEMCVKQITNKVHLTLCSCSVGYGGEKCEIL
YVWKAFPHYRNVTVVDRCKLGNICRNDGTCIDGICFCTDGFSGKICEKEMTIYEMDVRTS
GILCTAFC
Download sequence
Identical sequences XP_001893134.1.25112 Bm1_08315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]