SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001893154.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001893154.1.25112
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00000000426
Family Asparaginyl hydroxylase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001893154.1.25112
Sequence length 248
Comment chromosome 14 open reading frame 169 [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MLYIPRGYIHQGFADKDVHSLQLTVSVCRNVTYADLLERVIPPALSNFAEQNVNIRKSLP
ARYLDMTGVLECDYPLLKTGTIKLHRFLDSIFSNFCKYIKELSEPDVDMMAREFMRTALP
PVLTKEEKDMTALCVAGSSLYGDKEHIFTKNTPIKLLRRHGQRLIYESEERCFIVHRMAN
SRVYEGRPEVLFDLDVELAEGFANLVNAYPRWCLVSDLKCNDAADNIRLAELLYSNGLLM
AEFREAMR
Download sequence
Identical sequences XP_001893154.1.25112 Bm1_08415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]