SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001894927.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001894927.1.25112
Domain Number 1 Region: 32-102
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000565
Family Caspase recruitment domain, CARD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001894927.1.25112
Sequence length 113
Comment hypothetical protein Bm1_17350 [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MSADSQTLPCSRPLADSRIEQSYHLDQLRSKLARLDMRDLVPQLVARQVLRSQEMSAVYS
EEKREDQVDKLIEILKTKNHWLGPLIDALIRNGQATLAKELLAINNTKTNKST
Download sequence
Identical sequences A0A0I9N5P6 A0A0R3R916
Bm1_17350 XP_001894927.1.25112 Bm7324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]