SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001897163.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001897163.1.25112
Domain Number - Region: 15-94
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.00262
Family Helical scaffold and wing domains of SecA 0.012
Further Details:      
 
Domain Number - Region: 310-356
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0911
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001897163.1.25112
Sequence length 363
Comment hypothetical protein Bm1_28575 [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MSASIIVQATPVKANLEGLLXEIQQMDLTPLDQKATVEVLCQQYEARARIIKEKLMRLEK
YVGTLENINDKWLEHIQLAPMSQKKKEEKYEQMANDDRGILKLINIGTDTIITLSMYKDD
TELALKRLAQIKEPSLTECRPVLVRGYDRAPENYRIIRELLVEKFGRVSTIRKLLYNELI
STKRNNRDWKTIIEEMERVLKQLEAIGENVEQPTIETIIESKLPNWILNQKDGQWSVTKL
RQLLRKTINRNDQVMEWQYLDNVSRKNLIKRHPNASIPENSALIAIKQSKQTRGTASAER
NQLNQENPNWSTNKKRRPCIFCNNNHWDSKCHIYSTVEQRIDRLKEINVCSNCFKSGHKN
STA
Download sequence
Identical sequences A8PJX0
XP_001897163.1.25112 Bm1_28575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]